PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0273s00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SBP
Protein Properties Length: 980aa    MW: 108078 Da    PI: 5.6998
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0273s00180.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.53.7e-23155203149
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                        +Cqve+C+adls+ak+yhrrhkvCe+hska+ +lv + +qrfCqqCsr 
  Vradi0273s00180.1 155 VCQVEDCSADLSKAKDYHRRHKVCEMHSKASRALVGNAMQRFCQQCSRL 203
                        6**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.0E-23149203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.187153228IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-21154204IPR004333Transcription factor, SBP-box
PfamPF031101.7E-16156203IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.44E-8747865IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.0E-6751867IPR020683Ankyrin repeat-containing domain
CDDcd002042.84E-7753864No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 980 aa     Download sequence    Send to blast
MEARFGAEAY HFFGVGASSD LRGMGKRSSE WDLNDWRWDG DLFIASRLNP VPVDGVGVGQ  60
QFFPLGSGIP VVGGPSNSSS CSEEVDPRDP KGNKEGDKKR RVIVLEDDGL NEEAGTLSLK  120
LGGHASGVVD REVASWDGMN GKKSRVSGST SNRAVCQVED CSADLSKAKD YHRRHKVCEM  180
HSKASRALVG NAMQRFCQQC SRLPVALADA LEGCPKALLF LLVTTSTFTD RSNQTTDQDL  240
LTHILRSLAS QNGEQAGKNI SNLLQEPENL LREGGSSRKS EMVSTLFSNG SQGSPTVTRQ  300
HEAVSMAKLQ QQVTHAHDAR ASDQQITSSI KPSMSNSPPA YSEARDSTAG QIKMNNFDLN  360
DIYIDSDDGM EDLERLPVST NLVTSSLDYP WAQQDSHQSS PPQTSGNSDS ASAQSPSSSS  420
GEAQSRTDRI VFKLFGKEPN DFPLVLRAQI LDWLSHSPTD MESYIRPGCI VLTIYLRQAE  480
ALWEELCYDL TSSLNRLLDV ADDTFWRNGW VHIRAQHQMA FIFNGQVLID TSLPFRSNNY  540
SKILTVSPIA VPASERAQFS VKGVNLIRPA TRLMCALEGK YLVCEDTQMS MDQCSNEPDE  600
LQCVQFSCSV PVMNGRGFIE IEDQGLSSSF FPFIVVEEDV CSEICTLEPL LEISETDPDI  660
EGTGKVKAKN QAMDFIHEMG WLLHRSRLKL RMVHLNSTVD PFQLKRFKWL IEFSMDHDWC  720
AAVKKLLNLL FDGTVNAGDH PSLYLALSDM GLLHKAVRRN SKQLVELLLR YVPENISDEL  780
GPEVKALVDG ENKTFLFRPD VVGPAGLTPL HIAAGKDGSE DVLDALTNDP CMVGIEAWKN  840
ARDSTGSTPE DYARLRGHYA YIHLVQKKIN KRHGAAHVVV EIPNNTTESN TNQKQNETST  900
SFEIGKPAVR LSQGHCKLCD SKISCRTAVG RSLVYRPAML SMVAIAAVCV CVALLFKSSP  960
EVICMFRPFR WETLDFGTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-22156205655squamosa promoter-binding protein-like 12
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492405.10.0PREDICTED: squamosa promoter-binding-like protein 1
RefseqXP_014492406.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A0L9TY710.0A0A0L9TY71_PHAAN; Uncharacterized protein
STRINGGLYMA02G01160.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1